PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.166030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 204aa    MW: 22271.7 Da    PI: 7.5848
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.166030.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601322.5e-41521511100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe +r+da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+la
  Cucsa.166030.1  52 PCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHRVFGASNIIKFLQELPECQRTDAVSSMVYEANARLRDPVYGSAGAICQLQKQVSELQAQLA 146
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  Cucsa.166030.1 147 KARAE 151
                     99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.53951152IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-4152149IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MAYVAKCTNN SPPTPISVNN NPNNPLSFSP MSSSPPTSQP SSPPPPAVVL SPCAACKILR  60
RRCVEKCVLA PYFPPTDPLK FTIAHRVFGA SNIIKFLQEL PECQRTDAVS SMVYEANARL  120
RDPVYGSAGA ICQLQKQVSE LQAQLAKARA EVANMQQQQA NLLALICMEM RQSPEPVWQP  180
QLVDTTCFLD DATLSSPWEP LWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818961e-161LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132641e-161LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143693.11e-147PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-72LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0A0KNK91e-124A0A0A0KNK9_CUCSA; Uncharacterized protein
STRINGPOPTR_0008s04350.18e-88(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-66LOB domain-containing protein 1